PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01000175001
Common NameVITISV_040997
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 63aa    MW: 6991.33 Da    PI: 11.2723
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01000175001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.13.1e-25953145
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                       k+ienk  rqvtf+kRrng+lKKA+E+S+LCd+eva++ fs++gk
  GSVIVT01000175001  9 KKIENKAVRQVTFAKRRNGLLKKAYEISTLCDIEVALLAFSPSGK 53
                       78*****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-32160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.338161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.29E-25259IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-23323IPR002100Transcription factor, MADS-box
PfamPF003194.0E-241055IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-233859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MGRQRVEIKK IENKAVRQVT FAKRRNGLLK KAYEISTLCD IEVALLAFSP SGKPTIFGGK  60
KR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4622511e-101AM462251.2 Vitis vinifera contig VV78X147749.46, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010652754.18e-35PREDICTED: MADS-box transcription factor 18-like
SwissprotQ1PFC21e-24AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLA5BK392e-35A5BK39_VITVI; Putative uncharacterized protein
TrEMBLD7TTB72e-38D7TTB7_VITVI; Putative uncharacterized protein
STRINGVIT_07s0129g00650.t016e-38(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.19e-26AGAMOUS-like 66